SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620923|ref|YP_003709060.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620923|ref|YP_003709060.1|
Domain Number 1 Region: 296-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.5e-44
Family Ribonuclease PH domain 1-like 0.0000379
Further Details:      
 
Domain Number 2 Region: 9-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.11e-43
Family Ribonuclease PH domain 1-like 0.0000542
Further Details:      
 
Domain Number 3 Region: 452-551
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.94e-27
Family Ribonuclease PH domain 2-like 0.0000843
Further Details:      
 
Domain Number 4 Region: 145-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.85e-25
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 557-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.55e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 622-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.59e-20
Family Cold shock DNA-binding domain-like 0.0011
Further Details:      
 
Domain Number 7 Region: 239-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 5.49e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297620923|ref|YP_003709060.1|
Sequence length 698
Comment polyribonucleotide nucleotidyltransferase [Waddlia chondrophila WSU 86-1044]
Sequence
MEKKSMKVVVGEEEITFETGQIARQANGAVVVKSGETMLFCSACATAEPLENVDFLPLRV
DYQEKFASAGKTLGGFIKREGRPTERETLVCRLIDRPIRPLFEEGYYQDTQLLSYVWSYD
GVNSPDALAICAASAALTISDIPLKKAVGAVRVGMIDGQFILNPTVEHQEKSVLDLMIAG
TEDAVLMIEGYCKFLTEEQVIEAISIGHQGIQTICRALENWRQEVGKPKNLSKLKPLAKE
VIDAVEELVKDDLNQVLQIVDKKEREEAFDQIKKRVNETLCPEGEEAPKFEALEVAKAFK
KVSSGHMRRMIVKENKRSDGRATNQVRPIWIEQGLLPRTHGCSLFTRGETQTVAICTLGG
NNMAQRYEDLNGEGSRSFYLQYFFPPFSVGEVGRVGPPGRREVGHGKLAERALASILPSK
EEFPYTIRLESNITESNGSSSMASVCGGCLAMMDAGVPITRPVSGIAMGLILEENHYTIL
SDILGIEDALGDMDFKVTGDKNGITAFQMDIKVEGITIDIMRAALAQAKEGRIHILEKMF
EACPEPKKQMSKYAPRIEVLKVKPSKIGTIIGPGGKQIRAIIEETGAEIDIDDEGFVTIS
SSNLDGLQKAKRIIEDLTAEVEIGKVYEGKITSVVPFGIFVEILPGKEGLCHISEFDTQR
TNDLNEVVKVGDNVRVKVMDINERGQLVLSRKVLLVSK
Download sequence
Identical sequences D6YV93
WP_013181773.1.19835 WP_013181773.1.67671 gi|297620923|ref|YP_003709060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]