SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620945|ref|YP_003709082.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620945|ref|YP_003709082.1|
Domain Number 1 Region: 4-140,175-382
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.51e-96
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000029
Further Details:      
 
Domain Number 2 Region: 387-588
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 7.66e-44
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000744
Further Details:      
 
Domain Number 3 Region: 575-673
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.9e-28
Family Myf domain 0.0001
Further Details:      
 
Domain Number 4 Region: 141-175
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0000000196
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297620945|ref|YP_003709082.1|
Sequence length 674
Comment Methionyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
Sequence
MSRQKVLITSALPYANGPLHFGHIAGAYLPGDCYARFQRLIGSDTLYICGSDEYGVAITL
SAEIAGRTPKEHVDLYHEVIKGLFQKLNLSFDHYSRTTWEGHEKPVHQYFKDLLENGYIE
EKVTDQLYSEQDKRFLADRYVVGVCPGCGFDCARGDECPQCGASYEATDLKNPRSKLTNA
PLTRKATKHWFLKLDRFKERLTEWLNSKEWKPNVVNFVKGYIKNLRPRAITRDSEWGVPV
PLSNTEGKVLYVWFDAPIGYLSATMEWALKKGDPEQWKAYWCDESTTLVNFIGKDNIPFH
AAIFPAMTMGQNQPYKLVDHLPANEFYLLEGRQFSKSEGWYIDLDQFFERYTADQIRYAI
AANAPETSDSEFTWKDFQYKCNGDLLGKYGNLANRIMVFSHKNVHGKVPARKNLDEVDKA
FLSSIDVLVDQAFQCYQSFSLRKACQVIMELAQRGNIYFDGKQPWKLAKDPEQREVLETV
LSCCLECLKALALISSPILPETADKLWTMLGFEGRLSDTGWQKAAAMEIPVGQKLGQPQI
LFKKIEDEQIEEELAKLKALSKKHQPTEKLLEIEQFKQLDLRVGEIVSAEEIQKSKKLLK
LQVNLGEENRTIVSGIRPHYQADQLIGKKVVIVANLKPAKLMGIESQGMVLCGSDGKIME
LLSVDTLPAGSRIS
Download sequence
Identical sequences D6YVB5 F8LCL0
WP_013181795.1.19835 WP_013181795.1.67671 gi|297620945|ref|YP_003709082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]