SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621094|ref|YP_003709231.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621094|ref|YP_003709231.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 2.75e-39
Family Transcription factor NusA, N-terminal domain 0.0000578
Further Details:      
 
Domain Number 2 Region: 202-279
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.79e-27
Family Prokaryotic type KH domain (KH-domain type II) 0.00021
Further Details:      
 
Domain Number 3 Region: 127-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000195
Family Cold shock DNA-binding domain-like 0.016
Further Details:      
 
Domain Number 4 Region: 280-343
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.000000000595
Family Prokaryotic type KH domain (KH-domain type II) 0.0011
Further Details:      
 
Domain Number 5 Region: 363-421
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000267
Family DNA repair protein Rad51, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297621094|ref|YP_003709231.1|
Sequence length 424
Comment Transcription elongation protein nusA [Waddlia chondrophila WSU 86-1044]
Sequence
MNKDLVAIFEYLEKEKGIQREIVIHAIEESLQAAARKSVSGASNVTVQIDPKTGNINVFS
EKEIVDEVEVPAQEILLEEAREIDPDCEIGQFIDILATPKDFGRIAAQKARQIISQKLRS
AERDVIYEEYRHRVNEVVSGTVKRFVKGANLVVDLGKVEALMPMRQYPKTEKYKIGDRVL
ALLMEVNDTDSGGAEVILSRSSPEFVRQLMIQEVPEIVEGIVVIDKIEREAGYRTKLTVR
ATDQKVDPVGACVGMRGNRVKNVVRELNSEKIDIIPYSDDPIELLQNALSPIEIRKISIS
EDDRVISIVIDDDDYAAVIGKKGMNARLNSRLIGYELEVQRMTDYNKTMAIQRTELAESD
DPTLDHPLTGIEGVNKLVFEHLVAEGFNTPRTLLLASPEQLSNAASISLEMADHILEQVR
KQRL
Download sequence
Identical sequences D6YVR4 F8LA49
gi|297621094|ref|YP_003709231.1| WP_013181939.1.19835 WP_013181939.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]