SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621095|ref|YP_003709232.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621095|ref|YP_003709232.1|
Domain Number 1 Region: 280-393
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.79e-27
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 214-301
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.7e-26
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 3 Region: 453-550
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.7e-24
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Domain Number 4 Region: 371-460
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.09e-21
Family Cold shock DNA-binding domain-like 0.003
Further Details:      
 
Domain Number 5 Region: 40-137
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.52e-18
Family Cold shock DNA-binding domain-like 0.011
Further Details:      
 
Domain Number 6 Region: 113-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.56e-18
Family Cold shock DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297621095|ref|YP_003709232.1|
Sequence length 568
Comment 30S ribosomal protein S1 [Waddlia chondrophila WSU 86-1044]
Sequence
MSNKQEHSWDDANILDDVQYKEEDAKTFQQLMQTSTDASTDENQPMKPGSILKGKIVEIS
KEFVVVDVGLKSEGLVPMEEFSDPSQIILGNEIEVFLDEAEDSNGQIILSREKAEKLRKW
EFILEHCEEGSIVKGKVIRKVKGGLMVDIGMEAFLPGSQLDNKRIKNLDEYIGQTYEFKI
LKINIDRKNVVVSRRELLEAERISKKAELLATISEGDIREGIVKNITDFGVFLDLDGIDG
LLHITDMTWKRIRHPSEMVKIGDKLEVMILSVDRDKGRVALGLKQKESNPWDEIEQKYPP
GTRVKGKIVNLLSYGAFIEIEDGIEGLIHVSEMSWVKNVTDPSEVVNKGDEVEAIVLSVQ
RDEGKISLGIKQTERNPWDEVEEKYPVDKNVKVEVKSLTNYGAFVELEPGVEGLIHISDL
SWIKKVSHPSEILKKGDMVDAVILSVDKESKKITLGVKQLGSNPWEDIKETMPIDSIVKG
TVSKITAYGAFVELDNGLEGLIHVTELSDEAFGKVEDVVSVGADVTAKVMKVDPEHKKIS
LSIKEHMFDKTQSSRDDVVVSNESDMRD
Download sequence
Identical sequences D6YVR5 F8LA50
gi|297621095|ref|YP_003709232.1| WP_013181940.1.19835 WP_013181940.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]