SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621102|ref|YP_003709239.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621102|ref|YP_003709239.1|
Domain Number 1 Region: 65-126
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000857
Family Cold shock DNA-binding domain-like 0.0022
Further Details:      
 
Domain Number 2 Region: 129-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000857
Family Cold shock DNA-binding domain-like 0.0024
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000373
Family eIF5a N-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297621102|ref|YP_003709239.1|
Sequence length 185
Comment Elongation factor P [Waddlia chondrophila WSU 86-1044]
Sequence
MVLSNQINPGMILSIGKKLFRVESSVKVTVPKGTPFIKTKLCDLANNQVTEKNFKLDQEV
SEVNLNERPLEFLYKEGKEFLFLDVKTLDQILVPNPVVGEKINYLKEGIEVAAAFYGDTV
FSIELPQFLELMVSTTEGDQDLSPLSNATKVAVLETGAKVEVPPFIEPGDIIKVDTKTSE
YIQRV
Download sequence
Identical sequences D6YVS2
WP_013181947.1.19835 WP_013181947.1.67671 gi|297621102|ref|YP_003709239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]