SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621275|ref|YP_003709412.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621275|ref|YP_003709412.1|
Domain Number 1 Region: 221-616
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.14e-125
Family RNB domain-like 0.00000666
Further Details:      
 
Domain Number 2 Region: 65-145
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000171
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 3 Region: 625-688
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000261
Family Cold shock DNA-binding domain-like 0.0066
Further Details:      
 
Weak hits

Sequence:  gi|297621275|ref|YP_003709412.1|
Domain Number - Region: 136-236
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00127
Family Cold shock DNA-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297621275|ref|YP_003709412.1|
Sequence length 709
Comment ribonuclease R [Waddlia chondrophila WSU 86-1044]
Sequence
MSKRSKNERIYKNLLQVTEQFMSGKNFVPSTRKELMRKLHLPDEHKHVFKEVLRSLCQTN
ACKFFRGRYHPKKRNVDVVTGTISIHPRGFGFVSLDDPSLYDKDVFIPRHLTENAVDGDR
VEVEINPFSHSEKGPEGKVHTVVERGRTHLAGIVHEFSRDGTALAYVPLLGVEHQVSIKS
PDEKLHVGERVILEVLQWGDDKKETKTCLSHKIGHISDPSKDVIAAVKEYGLKKEFPEPV
KKEAALFGKSVKQSELKDRQDFRSWEIFTIDPTTAKDFDDALSLSKDKTGNYHLGVHIAD
VSHYVKSDSALEKQARMRCNSTYFPGVCIPMLPPSLSENLCSLKPNVNRLTASVLMTFDS
NGSLLNYRIVKGVIKSKKRFTYREAKEVLDGRKKSPFAPTLKLMEELCLLLKKKRYERGS
LEFSIPELRVIVDENGTPTGTEFIPYDITHQLVEEFMLKANEVVATHLSKEGLDLTYRVH
EEPSEERMNEFVSLANAFGFHLKEAPSPGDLQKFFDEALQTPYGTYLAISYIRRMKLAIY
SPANIGHYGLALTHYCHFTSPIRRYVDLVIHRLLFEKPISYSEIEAVAKECSEKERISEK
AERNVTLLKKLRLLKQMVDEEPKKEFEVVVTKIRSFGIYFEVDHLMLEGFLHVSELDDDY
YRYDERSGRLKGSYTGVAFFAGDRFSVISKEIDLIVLEAKWKFKKKRKK
Download sequence
Identical sequences D6YW95
gi|297621275|ref|YP_003709412.1| WP_013182120.1.19835 WP_013182120.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]