SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621454|ref|YP_003709591.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621454|ref|YP_003709591.1|
Domain Number 1 Region: 3-314
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 9.28e-105
Family Adenylation domain of NAD+-dependent DNA ligase 0.000000232
Further Details:      
 
Domain Number 2 Region: 400-578
Classification Level Classification E-value
Superfamily RuvA domain 2-like 8.15e-57
Family NAD+-dependent DNA ligase, domain 3 0.0000859
Further Details:      
 
Domain Number 3 Region: 314-396
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-26
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00048
Further Details:      
 
Domain Number 4 Region: 590-664
Classification Level Classification E-value
Superfamily BRCT domain 2.78e-19
Family DNA ligase 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297621454|ref|YP_003709591.1|
Sequence length 665
Comment NAD-dependent DNA ligase LigA [Waddlia chondrophila WSU 86-1044]
Sequence
MKKENYEALCKEVWEHNKRYYIDHAPLINDEEFDLLLKELEEIEKMHPEWIDPNSPTQRV
GEMLTEGFPTALHQTPMLSLANTYSKEEVDEFIKRMEKLAGHKEMAFSCELKMDGIAVAV
TYEQGGFVRAVTRGDGKKGDDISANLKTIPSLPLKLIDGKTLNRIEVRGEVYMPVNAFET
LNKTRKESNEALFANPRNAAGGSLKLLDPKATAQRSLAVVFYGISDPESLGLHSQYDVHG
FLGSLGLPTLEYRRQCFSREEIWNFVEEVRKKRETLSYQIDGIVIKLDDLAQQKRLGSTG
KQPRWAVAYKFAAEQTETRIRDIIVQVGRTGVITPVAELEPVLLAGSTISRATLHNEEEV
ERKDVRIGDSALIEKGGDVIPKVISINPEKRREGSMPWKMPDVCPSCGHPLVRVEGEVAV
RCPNREGCPEQLLRRIAYFVSKEAMEIDHLGEKVVKQLIRIGYVKRPSDIYTLTKEQLLN
LEGFKEKAAERLKQGIENSKHVSFSRFIMALGIKYVGAGTAELLANRSGDIDGLKQLSYE
ELLKINGIGEKAAESVIEYFSDAENLKEIERLKKFGVCPQKVERKTFIGHPFNNKTFVLT
GTLENYTRTAAASLIKERGGKVTGSVSKKTDYLLAGESPGSKLEKAESLGIQVLTESEFV
KMINI
Download sequence
Identical sequences D6YWS4
WP_013182297.1.19835 WP_013182297.1.67671 gi|297621454|ref|YP_003709591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]