SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621717|ref|YP_003709854.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621717|ref|YP_003709854.1|
Domain Number 1 Region: 133-275
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.62e-53
Family C-terminal domain of ribosomal protein L2 0.00000643
Further Details:      
 
Domain Number 2 Region: 2-129
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.46e-44
Family Cold shock DNA-binding domain-like 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297621717|ref|YP_003709854.1|
Sequence length 281
Comment 50S ribosomal protein L2 [Waddlia chondrophila WSU 86-1044]
Sequence
MLKKYRPRTPGTRQLILPKREQLTRPNKNNRKVVEPTKSLLLPKKRTNGRNNLGRITCRH
KGGGHKRKYRIVDFKRDKWNIPAKVASIEYDPNRSAYIALLNYVDGEKRYIIAPQGLKEG
AVVMTSDKPPYSVGCCMKLKDMPLGSVVHCIEMIPGRGAKLVRSAGMSAQLMARSGGYAT
LRMPSGEVRMVNESCKASFGSVSNPEHSLRVEGKAGRNRWKGIRPTVRGTAMNPVDHPHG
GAEGRNKGNIPQTPWAMYTKGYRTRSISKSRKLIVKDRRKK
Download sequence
Identical sequences D6YS03 F8LA70
gi|297621717|ref|YP_003709854.1| WP_013182556.1.19835 WP_013182556.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]