SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621744|ref|YP_003709881.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621744|ref|YP_003709881.1|
Domain Number 1 Region: 3-325
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.16e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000956
Further Details:      
 
Domain Number 2 Region: 334-422
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.71e-20
Family Anticodon-binding domain of Class II aaRS 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297621744|ref|YP_003709881.1|
Sequence length 480
Comment Histidyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
Sequence
MNIKAPPGVFDILPIDPKTPWKESHLWIYVEKVIRETAAQYGFQEIRTPILEKTELFQRG
VGETSDIVSKEMYMFNDRGGRSLCLRPEGTAPVIRSYIENNLSHQVPIHKFFYIGPMFRY
ERAQAGRYRQHHQFGAEVIGTQAPEQDAEVIDLLYTTYRKLGLQNLKVMINSLGDKECRL
HFRHALKEYFSQHKKHLSEESRQRLDKNPLRILDSKSPQDQEFIEKAPSILDFLSHEVKT
HFERVQEYLTFLEIPFAINPHLVRGLDYYNRTVFEVAAEELGAQNSIGGGGRYDSLIKEL
GGPDQPALGFGTGIERIIQTLLKQEAPVPSAYRPTFFLIPLGEKAKRACFKVLHFLRENS
IDAQMDFTGRKLGKVMGYANQIGAKFVAVVGDQELETETVELKNMETGEAISAPLYHLSR
ILRIESAGEDLIRMWADFNTPFKEPLEAKFFHDKIKSSIDHTKKLTKELQDAMEKMESFL
Download sequence
Identical sequences D6YS30 F8LB57
gi|297621744|ref|YP_003709881.1| WP_013182583.1.19835 WP_013182583.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]