SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621783|ref|YP_003709920.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621783|ref|YP_003709920.1|
Domain Number 1 Region: 98-465
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.03e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000524
Further Details:      
 
Domain Number 2 Region: 15-105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.5e-19
Family Anticodon-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297621783|ref|YP_003709920.1|
Sequence length 467
Comment asparaginyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
Sequence
MRTKIKDLKNPPKGFQEIIGKEVTIKGWVRTVRNQKTFTFIEVNDGSTLSNFQVIADPEI
PNYQKLAEQLTTGTSVSIEGAIVESPGKGQAVEMQAKSIQIIGSCDVENYPLQKKRHSFE
FLRSIAHLRPRTNTLGAVARVRSALAYATHKFFQEKGFIYVQTPVITASDCEGAGELFRV
STLDPEKAPRNEQGGIDYSKDFFERPAFLTVSGQLNGEIFALSHSDIYTFGPTFRAENSN
TSRHLAEFWMVEPEMAFCDLDMDMDNAEAYVKFLLQYLMDNCQEDLEFFDKFISKGLIDR
LKLIIETSFERASYTYAMRILEKSGERFDYPVRWGLDLQSEHERYLSEKYFNKPVFITDY
PKEIKPFYMRLNDDEKTVANMDLLFPKIGEIIGGSQREERHGYLKERMKEAKMNLDDYWW
YMELREYGTAPHAGYGLGFERMVQFATGVENIRDVIAFPRYPGKAEF
Download sequence
Identical sequences D6YS69 F8LAB0
WP_013182621.1.19835 WP_013182621.1.67671 gi|297621783|ref|YP_003709920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]