SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621803|ref|YP_003709940.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621803|ref|YP_003709940.1|
Domain Number 1 Region: 82-194
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000000000000162
Family RecO C-terminal domain-like 0.026
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000411
Family RecO N-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297621803|ref|YP_003709940.1|
Sequence length 228
Comment DNA repair protein recO [Waddlia chondrophila WSU 86-1044]
Sequence
METIRAEGIILQSLPVKDWDLLITAFTKEFGVMKFYYKKGQSKKRSKGALTSPLTCAEFI
CRKGNFDLIPLNEISVIDLHIDLRKTLEFLEYSCSWLKLIQRSQLPGKPAPNLYLLLKAF
LHSLPQFPKPETLHACFLLKLLRHEGLIELNPFCSVCSGPAAFQAGEPFCASHCSTNAIP
FNANELDLMQTLTFCRSLKEIENERIDFSFLEKISQLYRRIAEDFSTC
Download sequence
Identical sequences D6YS89
WP_013182640.1.19835 WP_013182640.1.67671 gi|297621803|ref|YP_003709940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]