SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621995|ref|YP_003710132.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621995|ref|YP_003710132.1|
Domain Number 1 Region: 67-134
Classification Level Classification E-value
Superfamily RuvA domain 2-like 1.73e-21
Family DNA helicase RuvA subunit, middle domain 0.0024
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000565
Family DNA helicase RuvA subunit, N-terminal domain 0.00068
Further Details:      
 
Domain Number 3 Region: 157-201
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.000000209
Family DNA helicase RuvA subunit, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297621995|ref|YP_003710132.1|
Sequence length 202
Comment Holliday junction ATP-dependent DNA helicase ruvA [Waddlia chondrophila WSU 86-1044]
Sequence
MIYFIRGILIQSTPGIAILETGGIGYKVHIPASTYPKLPQIGQEALLHTSMVVREVSQTL
YGFFYSEERDLFEELTTVSGIGPKIALALIGHLSVEEMHAAIGNQEVAMISKVPGIGKKT
AQRLVIELRDKVQKGGKYSLPSDFAIQVGTDSRGQKIADAMSALLNLGYNQSTAQKALKK
SLSNFPETIDLTELITDALKNV
Download sequence
Identical sequences D6YST1
WP_013182828.1.19835 WP_013182828.1.67671 gi|297621995|ref|YP_003710132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]