SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297622070|ref|YP_003710207.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297622070|ref|YP_003710207.1|
Domain Number 1 Region: 156-384
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.03e-49
Family G proteins 0.0000278
Further Details:      
 
Domain Number 2 Region: 79-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000008
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297622070|ref|YP_003710207.1|
Sequence length 391
Comment ribosome biogenesis GTPase [Waddlia chondrophila WSU 86-1044]
Sequence
MCYHLNMEDQENPTVSKRWIACPIEEEYLGSDRKQKRKERKEKSSRDRSKFKKTDKSKYT
DSLQKEIKERVVDQELFFGRVLSVTSQGIVVDCDREIYTCMIRGLLKREKTQTKTLVAVG
DIVRFAKMPDNEGMIVDVEPRKSILSRADNLSRKKEHLIAVNIDQVLITSSVVIPPLKPA
LIDRYIIAACKGGMRPVIIVNKVDLLDSHDFDDEARKEQRDLLEKCRQAYKEVGISFFEV
SVESRCGLDELKEAMRDQTSVFSGQSGTGKSSLINELTGLNLPVGDTVKQTRKGAHTTTQ
ARLVPLDCGGFCVDTPGIKSFGLWDLAQEEIQQYFPEIEKISSFCRFPNCTHTHEEKCQV
RKDVEDGNISPLRFESYLSLIESVVQKHHRR
Download sequence
Identical sequences D6YT06 F8LAZ9
WP_013182901.1.19835 WP_013182901.1.67671 gi|297622070|ref|YP_003710207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]