SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297620471|ref|YP_003708608.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297620471|ref|YP_003708608.1|
Domain Number 1 Region: 7-311
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.64e-63
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297620471|ref|YP_003708608.1|
Sequence length 314
Comment lysyl-tRNA synthetase-like protein [Waddlia chondrophila WSU 86-1044]
Sequence
MELEKIHILKDRSEMLAKAREFFLRRNVLEVDCPAMSKSASIDVHIDLYRCYGASQKTFY
LHSSPEYGMKKLLAEGIGDIYQLGHVFRDNEYSMRHNPEFTMAEWYRVKVPFSAIIEETV
EFIQEFIGKLPVTKISYREAFKKYAGLDYLKSSEDDLLQYLETRGIDPYQNIEEEGKDAL
LNIILGVVIEPQLGKNDICVLQYFPATQAALAKTKKRGEEEVSERFEVFHKGMELANGYH
ELTDSEEQYERLLITNSTRERLSKDTLPIDDSFIKALERGLPDCCGVSVGFDRLMMLRHQ
MDDIADVIPLPERS
Download sequence
Identical sequences D6YTZ1 F8LC37
gi|297620471|ref|YP_003708608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]