SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297621151|ref|YP_003709288.1| from Waddlia chondrophila WSU 86-1044

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297621151|ref|YP_003709288.1|
Domain Number 1 Region: 23-337
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.69e-68
Family Phosphate binding protein-like 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297621151|ref|YP_003709288.1|
Sequence length 339
Comment spermidine/putrescine-binding potD protein precursor [Waddlia chondrophila WSU 86-1044]
Sequence
MNLRKTCFFFLLVILSSCEDNRQRTLHIFTWSEMLDTRLVHEFEKEFNCHVVIDLYDSNE
SMYAKVKLGNSSYDILFPSNYYLEIMSKQGMVKPLNFDLIPNHLYLDPHYFNSESDPYGI
PFMLSYSGLGYRSDQVAPPPSSYNIFGSKEYIGRMTMLNDTREALGAALRTLGHSVNSTD
KNAIESAADLVIKWKQNLAKFESEQYKNGLINSEFLICQSYSSDILQVQVEADLVKFSFP
EEGAILSIDYITISEHSPEPELAHAFINYMIAPKAAALNIQRTHALTPIPSSYQLLPKHL
RENPILFPSEDQLKAMEKIRDLGSDVRLYYDAWERVKGS
Download sequence
Identical sequences D6YVX1 F8LD87
gi|297621151|ref|YP_003709288.1| WP_013181996.1.19835 WP_013181996.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]