SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507384824|ref|YP_008033903.1| from Idiomarina loihiensis GSL 199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507384824|ref|YP_008033903.1|
Domain Number 1 Region: 13-322
Classification Level Classification E-value
Superfamily SIS domain 4e-72
Family mono-SIS domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507384824|ref|YP_008033903.1|
Sequence length 325
Comment sugar phosphate isomerase [Idiomarina loihiensis GSL 199]
Sequence
MKQVTQNFRLLGEQVLDIEKKAIEGLYQYLDDNFDAACQTLFNCKGRVIVTGMGKSGHIG
GKIAATLASTGTPAFFVHPGEASHGDLGMVAAQDVVIAISNSGETAEVLNIIPVIKRLGV
PLISMTGKPGSTLARLADTHVCIAVEQEACPLGLAPTASTTATLVMGDAMAVALLNARGF
TADDFALSHPGGSLGKRLLLRLHDVMHTGERVPVIPADAIISDALLEMSRKGLGMTAIVD
ENQRLAGIFTDGDLRRILDNRIDVHKTPIAEVMTRSCITANEDMLAAEALKLMQDRKING
LIITNDDGQPCGAMNMHDLLQAGVL
Download sequence
Identical sequences A0A2D4RBE4 Q5R0I7
WP_011233662.1.4909 WP_011233662.1.75220 WP_011233662.1.75540 283942.IL0401 gi|56459512|ref|YP_154793.1| gi|507384824|ref|YP_008033903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]