SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|507384845|ref|YP_008033924.1| from Idiomarina loihiensis GSL 199

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|507384845|ref|YP_008033924.1|
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily SIS domain 1.28e-30
Family mono-SIS domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|507384845|ref|YP_008033924.1|
Sequence length 180
Comment phosphoheptose isomerase [Idiomarina loihiensis GSL 199]
Sequence
MNDELIKALFTESIQTQISAVESLTDEMATTVELLVANLLNGQRVFCCGDRTTGIVAQHF
ANLMTEGMKLERPPFPVLALALGKQKQLAALGQAGDILLVIADNQENEELASVMETAISR
DMLIIALTGEGNDSVSGLLGANDIELRAPSLNPARILETQLFIVHGLCEQIENTIFPQEH
Download sequence
Identical sequences A0A2D4R9T3 Q5R0L1
283942.IL0422 gi|56459533|ref|YP_154814.1| WP_011233683.1.4909 WP_011233683.1.75540 gi|507384845|ref|YP_008033924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]