SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|86605881|ref|YP_474644.1| from Synechococcus sp. JA-3-3Ab

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86605881|ref|YP_474644.1|
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily RbcX-like 5.89e-43
Family RbcX-like 0.00000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|86605881|ref|YP_474644.1|
Sequence length 135
Comment chaperon-like protein RbcX [Synechococcus sp. JA-3-3Ab]
Sequence
MDLKQIAKDTAKTLISYLTYQAMRTVLAQLSETDPPRALWLQQFSARQNLQEGETYLRAL
LAERPDLAYRIMTVREHIAAEVVDYLPEMAKTGIQQANMEHRRSHLERLTSAAGSPLATH
PEAGSPLQNPTPETE
Download sequence
Identical sequences A0A2G8NKF5 A0A2G8NUS2 A0A2G8P823 A0A2G8PBG2 A0A2G8PPE6 A0A2G8PTJ4 Q2JV66
gi|86605881|ref|YP_474644.1| 2015293158 321327.CYA_1195 WP_011430062.1.8981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]