SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332289817|ref|YP_004420669.1| from Gallibacterium anatis UMN179

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332289817|ref|YP_004420669.1|
Domain Number 1 Region: 18-489
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.18e-116
Family Pyridoxal-dependent decarboxylase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332289817|ref|YP_004420669.1|
Sequence length 510
Comment L-tyrosine decarboxylase [Gallibacterium anatis UMN179]
Sequence
MSMLSQHKQALFCRDEQSIQDYQRAMNKAVEAVCQWLQNDKMYTGGSIRRLRSTIEFAPT
KEGAGLENTLQRLVTIFLNPSLKVHHPHSLAHLHCPTMVSSQIAEVLINATNQSMDSWDQ
SPAGSIMEEQLIDWLRQKVGYGEGTAGVFTSGGTQSNLMGVLLARDACVAKHWQNEDGSE
WLVQQNGLPPDALQRVKVVCSENAHFSVQKNMAMMGMGFQSVVTVPTNKNAQMDIAALEK
TLAELQAQGKLVACVVATAGTTDAGAIDDIEAIRAISDQYGAWLHIDAAWGGALLLSKDF
RHWLNGLEKADSVTLDFHKHFFQTISCGAFLLKDERNFRFIDYKADYLNSEYDEEYGVPN
LVAKSLQTTRRFDALKLWFTMEALGEDLYASMIDHGVYLAREIRDYINATDDLEMLVEPQ
FASILFRVNPQGYPAEYVDLLNQNVADELFARGEANIGVTKVGEQQALKMTTLSPIATLD
DVKSLLDQVLSEAVRIKDAIVTGNYVPPIA
Download sequence
Identical sequences F4HD07
gi|332289817|ref|YP_004420669.1| WP_013746543.1.94406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]