SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310287623|ref|YP_003938881.1| from Bifidobacterium bifidum S17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310287623|ref|YP_003938881.1|
Domain Number 1 Region: 6-386
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 3.92e-126
Family ArgJ-like 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310287623|ref|YP_003938881.1|
Sequence length 389
Comment glutamate N-acetyltransferase/amino-acid acetyltransferase [Bifidobacterium bifidum S17]
Sequence
MSVTFAKGFSAAGVAAGISSVEGKKDLALVVNQGPLDSAAGVFTFNRFCAAPVQWSRKTV
ADGHIKAVVLNSGGANACTGQAGYEQSAATAKKVAELVGTQPDEIAVCSTGLIGELLPLD
HVLSGVESAYAALSDDDQAGSDASHAIMTTDTKPKTVSLEGDGYRIGGMVKGSGMIAPQL
ATMLCVITTDAAVGAGQLQAALNAAVDHSFNRIDVDGCMSTNDTVLLLASGASGVEPDPD
EFNALVAKACASLARQIIGDGEGASHDVRITVTGATTESAALACARAVAASNLLKCAIAG
NDPNWGRIVSSLGTVPVEEAPYDSQKVTVDVNGVRICENGGAGRDRSEVDMTPREVHIDI
DLNAGDEQATVWTDDLTHEYVHINADYES
Download sequence
Identical sequences E3ER35
WP_013363581.1.26466 gi|310287623|ref|YP_003938881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]