SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218961326|ref|YP_001741101.1| from Candidatus Cloacamonas acidaminovorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218961326|ref|YP_001741101.1|
Domain Number 1 Region: 44-331
Classification Level Classification E-value
Superfamily Folate-binding domain 4.55e-54
Family Aminomethyltransferase folate-binding domain 0.0000869
Further Details:      
 
Weak hits

Sequence:  gi|218961326|ref|YP_001741101.1|
Domain Number - Region: 345-370
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0425
Family Aminomethyltransferase beta-barrel domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218961326|ref|YP_001741101.1|
Sequence length 463
Comment aminomethyltransferase (Glycine cleavage system T protein) [Candidatus Cloacamonas acidaminovorans]
Sequence
MNSLGFKFPVQERKTALYNLEEEWYLPLLSKHLGIPMQSIKRSNFGQYSMAVNYLTSVLE
EAAAINKVAVYNIDHMTQLLFYGPDVVALLNRALTGNFTEMKVGQCKYTLLLNEQGGMQD
DMILMRVSDTSFILVINAGHDITDTIEVEGEKKEYLADIDRIMQCKKEGEEVWAKDISDT
LLKIDVQGPLSYKLLKEVYGESVLKNRNNPEKNMNFFTFNEFERNGHHYYLSRTGYTNRW
GWELYIPVAVAEEDAKIIISKALDFGGLLVGLGGRDENRISAGPFGLPLMGQEYDPYHTP
VNAPLFETAVDMNKEYFVGKEALVKEIVEGVQKRLYIFVSEGIVSNRGIYKDGKRLGTVT
SSINSPNVSWEMRLAIGSKRKNVNEEKGTAAIGMGWFYFPLFEKDNEGKEIAEIDEKPIR
IPVEFYREDENRKPTGTPVLGYVTLEGITPATAHKPLKNIENL
Download sequence
Identical sequences B0VHT0
gi|218961326|ref|YP_001741101.1| WP_015424753.1.99618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]