SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330838171|ref|YP_004412751.1| from Selenomonas sputigena ATCC 35185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330838171|ref|YP_004412751.1|
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000000209
Family FlgN-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330838171|ref|YP_004412751.1|
Sequence length 161
Comment FlgN family protein [Selenomonas sputigena ATCC 35185]
Sequence
MWREMKEVMRALSSCYAELVRVSEAKHKALAAMDLKAIERAVKEEERFAAEIERLETRRK
AALRVMAEKEAGIRPTMKMRELLAQCPDRRIAGELAALHEELDRRMKEVERFGERNTLLA
EGALAAVTANLNRIGGTAAGASYGAGGKESVTRERRFDFKA
Download sequence
Identical sequences F4EY84
WP_013740551.1.43677 WP_013740551.1.73955 gi|330838171|ref|YP_004412751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]