SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330838174|ref|YP_004412754.1| from Selenomonas sputigena ATCC 35185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330838174|ref|YP_004412754.1|
Domain Number 1 Region: 1-446
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.88e-39
Family Phase 1 flagellin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330838174|ref|YP_004412754.1|
Sequence length 446
Comment flagellar hook-associated protein 3 [Selenomonas sputigena ATCC 35185]
Sequence
MRIGSLQMVSRYQKQLNTAAEEQAKLMEQSDGQSLHRPSDDPVRYSNWLRYSTEQNENEQ
YKKNVDAGKSWMQRTDGAVSGMADIFKTLKEKTIQAAQSPHQNTDMAAIAKEMTAKLHEI
VSLGNSQQGDRYIFSGQSDLTQPFLLTEKKVARGVPKTLDDQQSKFFNNTNVSGRMKQMI
TLQGDDKNEYYLDTKTGDIYSYDFMKDGYKKKVAAGQTEVNPAADRAGTLGGAFNVSDNF
LNTGQIKDASTTPPAAAGKGANWSQSITVNGQTVNLKLKTIDQQIVKYQGDFKQISMVKK
NGAVEPTADTVNATAGDIFGTDIFDDENSGNTQSGTAAINDMLTVAAKVDSSDVNWLISD
GVTLADESHNNVVIAQDHIAARHNVYKGMADILDDYAVSIKQDISDTNSTDVAKLAVQLM
QASAIYNMSLSVGSRILPPTLTDYLR
Download sequence
Identical sequences C9LY25
gi|330838174|ref|YP_004412754.1| WP_006193748.1.43677 WP_006193748.1.73955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]