SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330838683|ref|YP_004413263.1| from Selenomonas sputigena ATCC 35185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330838683|ref|YP_004413263.1|
Domain Number 1 Region: 3-233
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.2e-33
Family Methylenetetrahydrofolate reductase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330838683|ref|YP_004413263.1|
Sequence length 248
Comment methylenetetrahydrofolate reductase [Selenomonas sputigena ATCC 35185]
Sequence
MSKVSLELVPRDEAALREELAQTKKYEGKIDLINVPDLLRLPVRSWEGAAIAGETFPAVP
HIRAMDIDITKPLPMADYLREHAIREVLVIEGDAPQNMAHTVYPTESIDVIRKFREEMPE
IRVFAGIDQYRGSMRQEDYRIRRKLQAGAVGFFTQPFFDRRFLAMYADMLEGIEVYWGLS
PVTSQRSESYWETKNQVVFPKDFEPTLAWSIAFARDVLAEARAKGEHVYLMPIRTGIDEY
LGGIFAEG
Download sequence
Identical sequences C9LVY8
gi|330838683|ref|YP_004413263.1| WP_006192933.1.43677 WP_006192933.1.73955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]