SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330839500|ref|YP_004414080.1| from Selenomonas sputigena ATCC 35185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330839500|ref|YP_004414080.1|
Domain Number 1 Region: 7-93,219-433
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.62e-82
Family Bacterial dinuclear zinc exopeptidases 0.0015
Further Details:      
 
Domain Number 2 Region: 94-217
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.92e-29
Family Aminopeptidase/glucanase lid domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330839500|ref|YP_004414080.1|
Sequence length 434
Comment Aspartyl aminopeptidase [Selenomonas sputigena ATCC 35185]
Sequence
MTTTAIPTAAEELLGFIQCSTSPFHVVEESAKRLLRAGFQELKPADSWRLAAGGRYFLRV
YGSTLLAFVVGEKPLKSHGTPLLMAAAHTDFPCFRLKPEAGMTRDGCGTLNIETYGGLIL
RTWLDRPLSLAGKIVLRGKDAFHPEVRLVDFQKPLMTIPSLAIHMDRDVNKDGALNAQKD
MLPLAALLGKDAEEDFFLAWLAEACETERDAILSYDLGAYPCETGCTFGLRDEFISSPRL
DNLTSVLACLKGIEEAHPTQGIRLIALFDNEEVGSRTKQGAGSAVLGDVLRRIYQDLSGE
SDAVCRALADGFLLSVDVAHAVHPSHAAKSDPVVRPALAAGVVLKQAASQSYAGDAEASA
VVRALAEEHEIPWQRFVNRADSRGGSTLGAIASSFVPVRTMDIGAPILAMHSARETMGAA
DQESLERLLTAFLA
Download sequence
Identical sequences C9LSS3
WP_006191353.1.43677 WP_006191353.1.73955 gi|330839500|ref|YP_004414080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]