SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147919366|ref|YP_686898.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919366|ref|YP_686898.1|
Domain Number 1 Region: 76-153
Classification Level Classification E-value
Superfamily E set domains 0.000049
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.032
Further Details:      
 
Weak hits

Sequence:  gi|147919366|ref|YP_686898.1|
Domain Number - Region: 159-229
Classification Level Classification E-value
Superfamily PA1994-like 0.0432
Family PA1994-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147919366|ref|YP_686898.1|
Sequence length 497
Comment hypothetical protein RCIX2504 [Methanocella arvoryzae MRE50]
Sequence
MNRSRIETGRLSCDAAAAQAQAVLILLFIVLMLAVTIELTVGDNIMAAADRISKFRVWGA
DNAISAPTGESSAITITSPVDGDTRYIDERITISGRLMPGQGRTIKLVFYRVSGGEWVKA
KITGDHWSGDTKRFTEGNYEIEAVAYDDLGMESEHAVSHFIVLFRYYVDARYVSDNLPVS
VIAGDRYPCQMTFENTGNTPWVNAQGYTLASYGGAFGADTIPVPEGGVLPSTSNVFSTVL
QAPGQPGSYVVTYRMQGGGYGWFGDEMTKTIRVDPVVRDAKVVSVDIPGEMLEGDVYQAK
ITMRNTGTGTWYVDGTNHVDLGMINGNTGDAYKFTGKTSMPMSGVTEVRPGGEYTFQFQI
KAPGPGDYSLKFRMIAEDSVWFGEQAEKSVKVNAKGQPGPGDEEPVEDYQAYVASGNFRI
IKGNGNERTNCMCVWCYDGPLVRHNLRSSYVKNDGYADWDIGGPNGNYRIYSDEYIGGSQ
FDMCNGGYKGTVTFYEI
Download sequence
Identical sequences Q0W221
351160.RCIX2504 gi|147919366|ref|YP_686898.1| WP_012035013.1.28485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]