SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147919428|ref|YP_686833.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919428|ref|YP_686833.1|
Domain Number 1 Region: 7-442
Classification Level Classification E-value
Superfamily L-aspartase-like 5.03e-126
Family L-aspartase/fumarase 0.0000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147919428|ref|YP_686833.1|
Sequence length 450
Comment adenylosuccinate lyase [Methanocella arvoryzae MRE50]
Sequence
MIFMAIHPIEFRYGTPEMKAVWTEEAKLRKLLLVEAALARAEAEVGIVPKECARIIGENV
DKVSVERVRAIEDEISHDMMAVVLGFAEVCGEEAGKWIHYGATSNDILDTGLGLQLKDSL
DIIEVKLQKLKMALLEKADATKTLVTAGRTHGQLAVPTTYGLRFAIWAMEVSRHQERLSQ
MRSRVAVGQMSGAVGTQAAFGKDGIRIKELTMSYLGIPAVTVSSQIIQRDRHAEYMMFLA
GVASTLDKICLEIRLMQRSEIGELAEGFGKKQVGSSTMPHKRNPINAEQVCGLARVVRSY
VEPALQNNVLWDERDLTNSSCERVIIPEASILLDHILNKAIRVITGLTFYPENIKRNLNV
LRGVQMSEAVMIALANRGFGRQKAHEIVREASMKAFEQGLTLKQALLENPEISAKLTPAE
VDMITDPEGYIGTAVEQVEEVLRKEGYKTK
Download sequence
Identical sequences Q0W286
gi|147919428|ref|YP_686833.1| 351160.RCIX2420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]