SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147919566|ref|YP_686694.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147919566|ref|YP_686694.1|
Domain Number 1 Region: 199-293
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 0.000000733
Family Aromatic compound dioxygenase 0.0047
Further Details:      
 
Domain Number 2 Region: 34-97
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000251
Family Pre-dockerin domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147919566|ref|YP_686694.1|
Sequence length 731
Comment hypothetical protein RCIX2252 [Methanocella arvoryzae MRE50]
Sequence
MKKVLALLLISFFVLQLIAAPNVYAASLPFTALGQVVDRHGKPVQGATVILYDGIYQEIG
RTVSDESGAFGFSNVVANSPGCKVKVEFKDSGTTYETSVVNTLWYPTDTGIVKFDIRDTT
LEKYPPPEYGFIWGVMQQDGSSQRPLGNGVVYASSGDQKFYTFTDNSKNRGTFLMRLPVG
HYKVWGQYMENGMIFQSSKILDVDVIGATNYLDSLSTTVLIPMSAAAQNPQPPEMPTQEQ
LNILSGYVTYKDGKPIPDQVVTLYQSTDDGMSGYLKVGEARTDQNGFYQFYGVQVTADAP
DNGIVYGSKGFNITTMYTDKNGQVYGDSKKITLYNPNFVTQDPSADHRARNPVVNFTIPY
STQGWVKINTINPEITGIKLYVDDKLITDSEGKPVTLPYTAYIEPGSHKIKITAPGYDDW
ETPVNIVENTPTQDVFVGMTKSVVPAWVPVAAAVVILILVVVAILALLFTKRQWILGIFG
GIIAPIQGALGKSLNNYKASSQTKKANRAQRAEARKAEQARMAQAREASRAKLDSKKSQE
KAFNARAEQPRLPEYRGEEEEVPSMVSAREIYKKQDRPAVERIPSSYANRGPSVIPPAAY
DDEPAPRAPAYEDREARAPAYEPRAPITSEPDGRIRLPRSMPIGRDQPPSASIKDKELVI
KYIREHPDGVSFIQMSNDLEIPPNTLTMITKELVINDDIEKIKGLYYYKSHDSSSDDRES
SVVVWRLDGED
Download sequence
Identical sequences Q0W2M5
WP_012035213.1.28485 351160.RCIX2252 gi|147919566|ref|YP_686694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]