SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147920001|ref|YP_686244.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147920001|ref|YP_686244.1|
Domain Number 1 Region: 125-367
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.77e-22
Family SGL-like 0.036
Further Details:      
 
Weak hits

Sequence:  gi|147920001|ref|YP_686244.1|
Domain Number - Region: 742-795
Classification Level Classification E-value
Superfamily E set domains 0.0252
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147920001|ref|YP_686244.1|
Sequence length 977
Comment hypothetical protein RCIX1696 [Methanocella arvoryzae MRE50]
Sequence
MGGGLIKVSIRFAAACIAVYVLLLIATAEVHAASASTTITDVVVNADRVTIYYALSNTAP
SLVQFEITDSKGSVVRTLSESGKLPGSHNIVWDCKDSSGKRVPTGTYTVKLAATGKIIGG
STEVLHDFYIDSDGMIFVTAAFGSSTGSILVYNSTASYWGSIGSDLEVPWGIAKKFDSGP
YYQGGTLYVTDYYGETLSTIKEGKQSTKGLSFEPKCAAFNSTGYLFILSSAGEGRVYVLD
SSGKLAYSFSVAYPTGLYIDSSDNIYVTGNDRLSIYTPAGSLTGTPFKVIGVGKGTGNNQ
FNQPTGVAVYNGRIYVADNMNKRIQIFDSNGNYIQTYLMINTAGEGVYPEYLHFDSNGNL
YMSTGHSLNAIYAPSSRSFTTVDIFPPTVTCKTNVTPRNGWYNSDVEVTVSVTDDYAGVK
SLKMGWNNDSISLVPVNLQDIPKFYFDDEGNTTLYWMCEDNANNVVYGNITISIDKTKPE
IYGAPDPLANAYGWHKGDVVVRFTASDARSGVAFTSSDVTVTGECTNWSVVGSAEDCAGN
RNTTSVLVSIDRTPPVITGGPTSVPNSNGWYNRSVQVNFTATDARSGVEHISPNVTLAGE
GSGQSATCTAVDKACNTATKEITGINIDLTAPQTKVSLSGTTGSSGCYVGDVTLTLSCND
SLSGVKTTEYSTDGSTWTTYSGPVTFSNEGTITVYYRSVDNADNVEDMKSVTFILDRTAP
VSSAALSGTMGDNDWYVSDVVVTITAVDKGPSGVRATEYSLDGSTWQPYTAPVTFPADGT
TTVYYRSVDNAGNLEADKQVSFKIDKTLPAITGTLSGERSSLGWFEGDASLSLSYGDDLS
GVRSVMYSLDGSSWHTYTGTVKIPKAGSHYVYYGVIDNAGNRKNGTSHVYFPPASVQYLW
SLISPTATPTPTPAVTPTPGAEVTPSPAVAPTPEVTPTPMPTTTVQTSPGNNWWLYLSGL
LVVGLAGAGAYFLFLRK
Download sequence
Identical sequences Q0W3X5
351160.RCIX1696 WP_012035647.1.28485 gi|147920001|ref|YP_686244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]