SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147920104|ref|YP_686136.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|147920104|ref|YP_686136.1|
Domain Number - Region: 37-106
Classification Level Classification E-value
Superfamily E set domains 0.0119
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147920104|ref|YP_686136.1|
Sequence length 151
Comment hypothetical protein RCIX1559 [Methanocella arvoryzae MRE50]
Sequence
MKRIRRKARGVKMLIFCALPASAGASPAARIDGWGTNKDEYRAGDAVSGFIRIRNEGSAP
IRNIDIEVRVVKETLVGGIEVHRKTYRASDFIPDFNIPPGETVIFHFPPAGQPPFTVPAT
SLARGKYHFTGRLTIGGTEIGRVEKSIRIVR
Download sequence
Identical sequences Q0W483
gi|147920104|ref|YP_686136.1| 351160.RCIX1559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]