SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147920228|ref|YP_686005.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147920228|ref|YP_686005.1|
Domain Number 1 Region: 107-170
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000314
Family Carboxypeptidase regulatory domain 0.029
Further Details:      
 
Domain Number 2 Region: 33-100
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000275
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|147920228|ref|YP_686005.1|
Domain Number - Region: 214-291
Classification Level Classification E-value
Superfamily E set domains 0.0113
Family Filamin repeat (rod domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147920228|ref|YP_686005.1|
Sequence length 446
Comment hypothetical protein RCIX1410 [Methanocella arvoryzae MRE50]
Sequence
MKLSTILLLPILLSLFLIATSTSALADSPVSVLVKDKNGAVGGALVSVQVNGITHSTQTD
LNGIGNFSLPPGQYYFTASKTGYASGSGTATVGDNSTVTIILTNLYTLSGTVIDSATGQP
VKDAAITITNKETDKSYTGGTNDNGVFSIPVSNGYYSVTVRAPFYQLTVMDDKGAGYHVL
DSSLYIGYLPIATDNNITSLNGVKLTTDYPGKVIKVNQTVTFDVTLTNNGIVDKSYAVSV
KDAPAGWNVQLLSGSDVISRVFVEKGSSRTFQVKTTPLSAGSHVITIVAGSEGDSGQVQL
YVDSTIDTDYKLEFSMPENLSLAAGTSKNVDVYVKNNGSGKLSSVRIDMGNDDIPESLNA
EVVTREASELAPGESKRFVVKITAKADASEGTERLYMRAVSAEAKTEQKYIEVSVTRSNS
WLGIGIGIALLAILAFGFIVWKYGRR
Download sequence
Identical sequences Q0W4L4
WP_012035872.1.28485 gi|147920228|ref|YP_686005.1| 351160.RCIX1410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]