SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147920257|ref|YP_685976.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147920257|ref|YP_685976.1|
Domain Number 1 Region: 668-928
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.33e-102
Family BC ATP-binding domain-like 0.000000272
Further Details:      
 
Domain Number 2 Region: 128-397
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.66e-102
Family BC ATP-binding domain-like 0.000000139
Further Details:      
 
Domain Number 3 Region: 392-541
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 2.75e-49
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000694
Further Details:      
 
Domain Number 4 Region: 1-126
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.31e-47
Family BC N-terminal domain-like 0.00000516
Further Details:      
 
Domain Number 5 Region: 545-670
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.21e-44
Family BC N-terminal domain-like 0.0000101
Further Details:      
 
Domain Number 6 Region: 932-1065
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 8.9e-38
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147920257|ref|YP_685976.1|
Sequence length 1080
Comment carbamoyl phosphate synthase large subunit [Methanocella arvoryzae MRE50]
Sequence
MPKRTDIKKVLLIGSGPILIGQAAEFDFSGSQACRSLREEGIQVVLVNSNPATIMTDPEM
ADAVYVEPITPQVVAQIIEKERPDGIIAGLGGQTGLNITSELAEMGVLEKFNVKLLGTPL
KAIYDTEDRDRFKHAMESIGEKVPRSIPCHSVEEAVKAVETLGLPMIIRSAFTLGGTGSG
VARTIEEVRQIAEIGIKRSRIHQILVEESILGWKEFEYEVMRDASDTCITICNMENVDPM
GIHTGESIVVTPSQTLSDADHQKLRTAAIKIIRALGIEGGCNIQFAWKDGDYRIVEVNPR
VSRSSALASKATGYPIARIAAKIAIGLRLDEIRNKVTMETPASFEPTIDYVVVKIPRWPF
DKFKTADKHLTTSMKSTGEVMAIGRSYEEALQKALNSLDISEFWGYGNWSKDEMAEILSK
PTHERMFVIFKALRTGAFTVEEIAKLSNIDPWFILKIKNIVDMAEKLKSAPLDRDLLLKA
KRLGFTDEWIAEIRGVTQEEISDLRHKLGIIPTYKMVDTCAAEFAASTPYYYSCYEQECE
LAPSDRKKVLIIGAGPIRIGQGIEFDYCTVHAVQALRESGIEAHIINNNPETVSTDFDTS
DKLFFEPITLEHVMNIIEKERPFGVMVQFGGQTSVNLAIPLQMELNRRKDLNTVIIGTSP
DDMNIAEDRDLWSRLMKEQGILQPESGIAYSIDDAKAVARRIGFPILVRPSYVLGGRAME
VVYDEADLERYMTEAVKVSRKHPVLIDDFLENAVEIDVDAVCDGKDVLIGAIMEHIEEAG
IHSGDSACVIPPQSLSPDVMDQVRVIVRKIALALRVVGCINLQMAYKDGKVYVLEANPRS
SRTIPFVSKATGAPLAKLAAKAIIGHSLKDLGYTEEPKPRHVSVKEVVLPFDKLPGADPV
LGPEMKSTGEVMGIDLDFGRAFFKAELSAFNSLPQEGTIFMSVRDADKEHMVKIAKILHD
NGLQLIGTAGTKEFLESHGIPIRQVLKVSEGSPNVIDLMREGKVQLVINTPTSKQARMDG
FQIRRAAVDYEVPYATTLQAAKASADAINAMGRRKPTIRSLNEYLDMDRPVAPVIDAAKE
Download sequence
Identical sequences Q0W4P3
gi|147920257|ref|YP_685976.1| 351160.RCIX1369 WP_012035901.1.28485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]