SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147920897|ref|YP_685296.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|147920897|ref|YP_685296.1|
Domain Number - Region: 806-859
Classification Level Classification E-value
Superfamily E set domains 0.00257
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147920897|ref|YP_685296.1|
Sequence length 1045
Comment hypothetical protein RCIX562 [Methanocella arvoryzae MRE50]
Sequence
MVAVAIALLVSLMPATLAADKADNKAPTSWVVDEDEYGNNWHDSTVSIHIKAKDDKNVDY
IMYSINGAPYIKKKGDSATFDISSEGINILKYYAVDKAGNVESTNTLQVRIDRSAPITTA
SSSGTGGVDGWFRSDVVITLTANDGAGSGVDYIRYKKSDGSWKKVNGNTASFSVTGQGVH
TIKYYSVDNVGREEEEKTLTVKIDTGKPTISVSPKPSAGWYTSKPTFTFTFADDRSGVYQ
HSPATVTQGDTTGTEILAWVTDKAGNREEKKFTVKVDTTAPSISGAPDRAPNAQGWYKAP
VTVTFTASDATSGIATVNPASTTLSGEGAGQSASSTATDKVGHTATATVRNINIDMTAPV
TTHSLSGTIGSDGWYTSDVTMTLSASDGLSGVKGIEYSTDGTTWTAYTAPVTFSAEGVTT
VYYRSIDNADNLEANKSVTFKSDKTQPSTTLTLSRPADSRKWYNAPVDISFTAEDATSDV
KTIYYQLVVNGVAGSWMTYTPGTSVNIASEGNTSVKYYSVDNAGNEEDKKSKVIRIDTVK
PTISVSPAPSASWYTGYPAFHFTFEDSTSGVFQHSASDVTVSTDSTGYEVVATATDRAGN
SEEMRFTVKVDTTAPTISGTPDRAPNAHGWYKAPVTVTFTAADATSTVASISPESRTFSD
EGADQSVTSTATDVAGNTATATVDNINIDMTAPATGYRLSGTTGSDGWYRGDVTMILSAS
DGLSRVKGTEYSTDGTTWTAYTAPVVFSVEGATTVYYRSIDNADNVEEARSVTFNIDKTA
PVSSASLVGIVGNNAWYVSDVVVTLSAMDAGSAGLRAIEYSLDNGVTWTTYTAPVTVSAD
GVTTVEYRSVDNAGNVETAKQFSFKVDKTAPELSGKLDGPRSSLGWFEGDAALTVTSSDL
TSGLSSVMYSIDGSEWKVYTGPVTVPYGGSHYVYYGAIDNAGNTKNGSSFAYFPPGTIQY
VWSIISPTATPTPTPTPTVTPTPEITPTPEVTPTPEITPTPTVTATPEPTTTAQTQPGDN
LWMYALFLAVLVLGGLGAYYFGIRK
Download sequence
Identical sequences Q0W6M3
351160.RCIX562 gi|147920897|ref|YP_685296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]