SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147921140|ref|YP_685049.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147921140|ref|YP_685049.1|
Domain Number 1 Region: 30-255
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0000000000000128
Family Acetylhydrolase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147921140|ref|YP_685049.1|
Sequence length 267
Comment hypothetical protein RCIX253 [Methanocella arvoryzae MRE50]
Sequence
MTAAEVARGRGIVYLLTYKVTTDTEIFLRKLNHFYSYVYAKVFNRPLFHVIGDSHTWAFK
RQRSFIVHNIGPATAYNLVNKNSSVQSNRKLFEVIRRIDIKKDVVIMVFGEIDCRVHFYN
QHMKSGGKVSIEELMDRTIANYGEVLAQLKGMGVNFVVYGVLPASKHVFRFPPYATEKIK
EDLFSEFRNSYPFLASPEVRSPINRRFNQKLKTFCEAHGYRYLDIYPVVADDRGLIKDEF
AADEIHVTGKIMPYVKSMLEKQGCPKA
Download sequence
Identical sequences Q0W7C0 Q5NW36
WP_012036776.1.28485 gi|147921140|ref|YP_685049.1| 351160.RCIX253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]