SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147921266|ref|YP_684920.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147921266|ref|YP_684920.1|
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000358
Family MarR-like transcriptional regulators 0.053
Further Details:      
 
Domain Number 2 Region: 445-550
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0000466
Family MJ1460-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147921266|ref|YP_684920.1|
Sequence length 581
Comment hypothetical protein RCIX90 [Methanocella arvoryzae MRE50]
Sequence
MEIDKKAVDSLTSFGLTEYEAKVYLALATRGVQKASALADISDIPRPHVYSVIKLLHEKG
LIIIIPEKVAKYQAVPIETVLNKLLQDRMESIRSLEAIGKDLTSMISENRNKSEEESGEK
VRLYNGRWAIMDLIHKMMGRATSSFKFITSDRGFLLTAAAYEQDIAALEKRKITAQFLLP
VEKDTITMVERLSKKASIRHLDSTDRLDMLDPAEQENAFLRVVVVDDSEVLFVRATPGGG
DESAIWTSQKELAKMISLMFRHMWRNAPDLTSKKAEIETGRKPEHLTPIYGDVELDGVLR
MILSNAQTRLRCVISQDQLVYNFNTIIAEIRSKAGKGLKAQILVSIRNDFGRGHTLAGKF
GDIAAIVDTMKALGVDIRHPLEESILSMYMNDEEVLFNLLGESATSSSGGNIGVYTNHYD
TIARITEHFDRLWDKSIDVSERISEINRYISKEVVKDGEEGIKKYFERLSGLNLGHFAIK
TSDPENKTITIICTDSAEARLEVKKAAHSDICESARSAFRSFGEYVYENTHMACSETKCI
SRGDPFCEFHLYPAEKDRKAVSNELVKFFESIKSERNKPKV
Download sequence
Identical sequences Q0W7P9
351160.RCIX90 gi|147921266|ref|YP_684920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]