SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147921440|ref|YP_684745.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147921440|ref|YP_684745.1|
Domain Number 1 Region: 162-353
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.13e-64
Family Actin/HSP70 0.000001
Further Details:      
 
Domain Number 2 Region: 355-511
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 4.71e-61
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000002
Further Details:      
 
Domain Number 3 Region: 4-160
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.77e-56
Family Actin/HSP70 0.00000403
Further Details:      
 
Domain Number 4 Region: 478-575
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000126
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147921440|ref|YP_684745.1|
Sequence length 623
Comment molecular chaperone DnaK [Methanocella arvoryzae MRE50]
Sequence
MSKILGIDLGTSNSEAAIMEGGKPVIIPSAEGARMFPSVVAFTKTGERLVGEAARRQAVT
NPERTIIAIKRKMGTDYKVEIDGKKYTPQEISAMILQKIKQDAEAYIGEKITKAVITVPA
YFNDNQRQATKDAGTIAGLEVLRVINEPTAAALAFGLDKKGSQKILVFDLGGGTLDVTIM
EMGDGVFEVLSTSGDTQLGGTDMDNKIIDYIASQFKKDTGIDLRNDKMAMQRLRDAAEKA
KIELSSTLQTQVNLPFITADASGPKHLDMMLTRATLEELVREVVERCYAPMRQAISDAKL
TANQIDRIILVGGPTRMPIIIETIKKFFGKEPERGIDPMECVAMGASIQGGVLAGEVKDL
LLLDVTPLSLGIETLGNVATRLIERNTTIPTRKSQVFSTAADNQTSVEIHVIQGERPMAY
DNTTLGRFHLIGIPPAPRGIPQIEVTFDIDANGILNVKAKDLGTGKEQAITITASTKLDK
SDIERMVKDAEKFAAEDAAKKEKAEVMNQADTLLYSAEKTLADAGDKITADQKERVTKGS
DALREAQKTGDIEKIKAATADLTKTMNEVATVLYQAAQQQYQQQQAAEQAAQQQSGGQQA
SGSNPGKDPNVVDADYEVVNDKK
Download sequence
Identical sequences Q0W874
WP_012037073.1.28485 gi|147921440|ref|YP_684745.1| 351160.LRC471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]