SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147921570|ref|YP_684613.1| from Methanocella arvoryzae MRE50

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147921570|ref|YP_684613.1|
Domain Number 1 Region: 44-174
Classification Level Classification E-value
Superfamily FAS1 domain 1.44e-20
Family FAS1 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|147921570|ref|YP_684613.1|
Sequence length 186
Comment hypothetical protein LRC313 [Methanocella arvoryzae MRE50]
Sequence
MVGIRKIVVILALAAILAALSAPAAAQGAAMQTTQQSKMQMETSGKNVIDTLSGMPDVSM
AASMLKSSEKEMKWAGSLHTLFIPTDAALSKMGMDQDRLNKVMSDRVVAGRAMQGFMSLG
EVKPSDMTDGKTLSMVSGNKVTIRNVDGQLSVDGAKITKAIKTTNGMIYIIDSVPPSMVT
MGFMSR
Download sequence
Identical sequences Q0W8K6 Q5NVY2
gi|147921570|ref|YP_684613.1| WP_012037203.1.28485 351160.LRC313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]