SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330837985|ref|YP_004412565.1| from Selenomonas sputigena ATCC 35185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330837985|ref|YP_004412565.1|
Domain Number 1 Region: 257-634
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.11e-111
Family GABA-aminotransferase-like 0.000000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330837985|ref|YP_004412565.1|
Sequence length 638
Comment 8-amino-7-oxononanoate synthase [Selenomonas sputigena ATCC 35185]
Sequence
MALYSLKMRAEKNAGKREHVSGAEKILSEEELPEHLAALLSRALHHAKGKADFVNFKVEA
IAPEAVEHLPALPVSTVEVETPAEGRRVIIDALENLGLKNGEAILAKFSETYGMRGAMLL
DADTLERLEPDAERGLRATYMDAERAAKGASDCKNHFAEAVVLATKVVHAPHIVAEICVS
DDPDYVTGYVAAQSFGYRRITKLKEAGSPDGGRIFLYRGSRDGVADTIRYLEKQCVLVRG
VPDSPAGNVRPQGMEEMLAEELAAKKARHLCREMHEIDSAQAAHVTVGGAEKLLLASNNY
LGLVDHPRLKRAAQEAVERYGCGSGGSRLTTGTLPLHTKLEEELAAFKGTEAALLFDTGY
MANVGILSALGQKGAVFFSDELNHASIIDGCRLSRAKTVVYRHSDMQDLEEKLAAHAQCP
GVIVSDAVFSMDGDIANLPRILELARKYHVWSMVDEAHSTGVIGATGRGICEHFYLREKP
DVLMGTLSKALASEGGYVCGSRLLIDYLKNTSRSFIFSTSQSPANLAAASAALQLLQEEP
ERVARLQENVRVFCAALAEHGVEARSETAIVPLIVGEESLAVKIAKDLERQGILVSAIRH
PTVAKGAARLRVALAATHTEEELKSAAARIASCMRGAC
Download sequence
Identical sequences C9LVH2
gi|330837985|ref|YP_004412565.1| WP_006192763.1.43677 WP_006192763.1.73955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]