SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333919618|ref|YP_004493199.1| from Amycolicicoccus subflavus DQS3-9A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333919618|ref|YP_004493199.1|
Domain Number 1 Region: 15-174
Classification Level Classification E-value
Superfamily PEBP-like 3.14e-49
Family Prokaryotic PEBP-like proteins 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333919618|ref|YP_004493199.1|
Sequence length 176
Comment hypothetical protein AS9A_1950 [Amycolicicoccus subflavus DQS3-9A1]
Sequence
MSNNPYASLPVLPTFELTSSDVKDGERLANPQVSGVFGAGGSDVSPQLSWSGFPPETKSF
TVSVLDPDAPTGSGFWHWAVANIPASVTELPAGAGQEDNSALPEGAVQLRNDAGFRGYVG
AAPPAGHGTHHYYIAVHAVATERIDLPETATPGFLGFNLFSQAIARAVIVGTYSQE
Download sequence
Identical sequences F6ENC8
WP_013806748.1.101151 gi|333919618|ref|YP_004493199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]