SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333920915|ref|YP_004494496.1| from Amycolicicoccus subflavus DQS3-9A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333920915|ref|YP_004494496.1|
Domain Number 1 Region: 3-317
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 8.24e-79
Family ATP synthase (F1-ATPase), gamma subunit 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333920915|ref|YP_004494496.1|
Sequence length 324
Comment ATP synthase subunit gamma [Amycolicicoccus subflavus DQS3-9A1]
Sequence
MGSLRELRSRIKTVNSTKKITKAQELIATSRIVKAQARVEQHTPYAEEITKVIGELTTAS
RSLDHPLLSEREDPKRAGVLVVTSDRGMCGAYNSNVLREAEELIQLLHSKKRDVVLYVLG
NKGLIYYTFRGRDVAGSWTGFSQQPSYSDASPASKHLVDLFMAGSGNHVDAPNGEGTVEG
VDELHIVFTKFQSMLSQKPLVRRMAPIEIDIEEEELKLGEDMLSSAPDADAPLAAWSFEP
DADSLLAEILPKYVSTRIYAALLEAAASESAARRTAMKSATDNANELANSLTRQMNQARQ
AMITQEISEIVGGANALASSAGSD
Download sequence
Identical sequences F6ENM7
gi|333920915|ref|YP_004494496.1| WP_013808045.1.101151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]