SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325989660|ref|YP_004249359.1| from Mycoplasma suis KI3806

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325989660|ref|YP_004249359.1|
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 2.49e-38
Family Obg GTP-binding protein N-terminal domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 325-386
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 0.0000000112
Family Obg GTP-binding protein C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325989660|ref|YP_004249359.1|
Sequence length 390
Comment GTP-binding protein Obg/CgtA [Mycoplasma suis KI3806]
Sequence
MSSYVKIKLQAGRGGDGIISWARNRYNSRMGPNGGNGGNGGSIYLVVNKKINDFSSINRY
LWKAENGFPGQRDSKFGLKGRDISIDIPENTEVYDFGEKIKRTTVTSDSPTYLVCRGGKG
GRGNKSFKSARYQSPQLYELGEKGEQRKILLILSKFKRIGIINLLDSENKAQNNWENLRE
ELCSQLSGIEFFDFPSEIFSKNINDFYSSHLELCRLFICVIHFDFLKGLQNLLLSIESKL
KERGFSKLLKIIYFDNEESLESSDDCIYINNLGDSDFSKVSSKLNWELSQFQGLPCFKSS
QVIDEEGFIEYSDEILPEKEELKILKNENVWEIQSSRLSYWTSRIPQTTWHNLERLREKL
KIEEIMKILKKQGGIEGEVIRIYNFETTIY
Download sequence
Identical sequences F0V3H9
gi|325989660|ref|YP_004249359.1| WP_013609008.1.94567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]