SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|523529823|ref|YP_008215850.1| from Acinetobacter baumannii BJAB0715

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|523529823|ref|YP_008215850.1|
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 8.37e-140
Family ArgJ-like 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|523529823|ref|YP_008215850.1|
Sequence length 406
Comment N-acetylglutamate synthase (N-acetylornithine aminotransferase) [Acinetobacter baumannii BJAB0715]
Sequence
MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSNVAGVFTQNAFCAAPVH
VSKAHLAEGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAELAGVNSFEVLPFSTGVIG
EQLPMERLLAGLQPALNSVQDAAWSDAASGIMTTDTVPKGASEQFELDGITYTMTGISKG
AGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSFNRITIDGDTSTNDSCIFVATGQ
AGGAEITSESDVRYAKVLEVLARVMNRLAQLIVRDGEGATKFITVAVEGGANTQECCDIA
YSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKIQVWLDDVQICKDGGAAEDYT
EEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences A0A0H4UTF4
WP_000268124.1.100849 WP_000268124.1.11135 WP_000268124.1.11500 WP_000268124.1.11977 WP_000268124.1.12703 WP_000268124.1.13263 WP_000268124.1.15159 WP_000268124.1.16082 WP_000268124.1.17616 WP_000268124.1.1863 WP_000268124.1.20127 WP_000268124.1.20532 WP_000268124.1.21462 WP_000268124.1.21644 WP_000268124.1.21810 WP_000268124.1.22793 WP_000268124.1.24846 WP_000268124.1.26831 WP_000268124.1.29927 WP_000268124.1.32223 WP_000268124.1.34657 WP_000268124.1.34917 WP_000268124.1.35273 WP_000268124.1.35291 WP_000268124.1.35337 WP_000268124.1.36289 WP_000268124.1.3720 WP_000268124.1.3836 WP_000268124.1.39517 WP_000268124.1.40552 WP_000268124.1.47219 WP_000268124.1.50164 WP_000268124.1.51536 WP_000268124.1.52310 WP_000268124.1.52426 WP_000268124.1.55484 WP_000268124.1.56353 WP_000268124.1.60408 WP_000268124.1.62023 WP_000268124.1.62683 WP_000268124.1.62800 WP_000268124.1.66752 WP_000268124.1.67578 WP_000268124.1.68015 WP_000268124.1.68603 WP_000268124.1.73056 WP_000268124.1.73238 WP_000268124.1.74318 WP_000268124.1.749 WP_000268124.1.74989 WP_000268124.1.75628 WP_000268124.1.76329 WP_000268124.1.7865 WP_000268124.1.80270 WP_000268124.1.82542 WP_000268124.1.85306 WP_000268124.1.86102 WP_000268124.1.87216 WP_000268124.1.94224 WP_000268124.1.9439 WP_000268124.1.96220 WP_000268124.1.96760 WP_000268124.1.97038 WP_000268124.1.97647 gi|523529823|ref|YP_008215850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]