SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|341581797|ref|YP_004762289.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341581797|ref|YP_004762289.1|
Domain Number 1 Region: 2-215
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.4e-44
Family Decarboxylase 0.0041
Further Details:      
 
Domain Number 2 Region: 215-404
Classification Level Classification E-value
Superfamily SIS domain 7.69e-40
Family mono-SIS domain 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|341581797|ref|YP_004762289.1|
Sequence length 406
Comment bifunctional D-arabino 3-hexulose-6-phosphate formaldehyde lyase/phosphohexuloisomerase [Thermococcus sp. 4557]
Sequence
MILQVALDLTDIEQAISIAEKAARGGAHWLEVGTPLIKKEGMRAVELLKRRFPDRKIVAD
LKTMDTGALEVEMAARHGADVVSILGVADDKTIKDAVEVARRYGIRVMVDLIGVKDKVKR
AKELEKMGVHYILVHTGIDEQVQGKSPLEDLEKVVKAVSVPVAVAGGLNLQTIPKVIELG
ATIIIVGGAITKAEKPDDVTRKIIDLFWGEYMMTIRKAMDDIIDHIHNVSESLKLEQVRG
FVDAMIGANKIFIYGAGRSGLVGKAFAMRLMHLDFNVYVVGETITPAFGQGDLLIAISGS
GETNSIVDAAEIAKKQGGKVVAITSYANSTLGKLADVVVEIPGRAKTDIPTDYIARQMLT
KYKWIAPMGTLFEDSTMIFLDGVIALLMATFQKTEKDMKKKHATLE
Download sequence
Identical sequences G0HNI4
WP_014012296.1.67626 gi|341581797|ref|YP_004762289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]