SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|341582196|ref|YP_004762688.1| from Thermococcus sp. 4557

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|341582196|ref|YP_004762688.1|
Domain Number 1 Region: 9-63,210-419
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.19e-30
Family Bacterial dinuclear zinc exopeptidases 0.021
Further Details:      
 
Domain Number 2 Region: 87-197
Classification Level Classification E-value
Superfamily PA domain 0.0000589
Family PA domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|341582196|ref|YP_004762688.1|
Sequence length 562
Comment putative leucine aminopeptidase [Thermococcus sp. 4557]
Sequence
MRRFLKEAEVFDPNNVLHYIAEISQFHRIQGSRELPEAVRFILEELRIWGIGADLYEETY
DGESRYLTLKSPIAWDVVRGAVEVLGTTLTTAGTPLVVMAHSPSGSAEGEVVHVVREDDW
EKARGRIVLVGREWREAYRRANEMGAVGFMAYREGTGEEVPYIGLFLTKDDLEWARIPAV
AVPETLARKIIGKLNSGESVSARIEVETVINERQVLPILYAEIGRPPFLLFTAHICHPKP
GANDNASGSAMLMELARVLSRLHDDSFRFGFAFLWVPEYYGTQAFIERHADLGKYYAAIN
LDMVAGSPDRAGSTIMLVRTPISRFSVVSGILEYYLDLANEAGKSFSGSPLPRLRVKSFP
YEMGSDHDIFNFFGIPGTMPITWPDRFYHSSGDTIDKVSGESVEVIGRAVLATALALAKG
DGEELQRFARGYAMKYLGELSRERKTDEVERLVMTGLARDSRFLGIESGHRFEPEPWLTW
KVRGLLSEHLIREADERLAEEFRSLTRDRRVLVHLHELLMLAELLPRERAFEALREEYGE
IDEEKLEKLVGILEAAGIVELA
Download sequence
Identical sequences G0HJ82
WP_014012694.1.67626 gi|341582196|ref|YP_004762688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]