SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219851069|ref|YP_002465501.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851069|ref|YP_002465501.1|
Domain Number 1 Region: 19-230
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.83e-32
Family Acetylhydrolase 0.042
Further Details:      
 
Domain Number 2 Region: 244-383
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-24
Family Family 6 carbohydrate binding module, CBM6 0.005
Further Details:      
 
Domain Number 3 Region: 414-467
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000341
Family Type I dockerin domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219851069|ref|YP_002465501.1|
Sequence length 468
Comment carbohydrate binding family 6 [Methanosphaerula palustris E1-9c]
Sequence
MHPLRSIPVCLLVTVLFLLLLVAPVVGTVRIVPIGDSITQGTLQNDDGLSHPTYRYWLWQ
TLKSRGYDVDFVGSVDQPQLPYSFDQDNEGHDGYRTRDLLGTDRLKTWLTGYSPDIAIVH
LGSNDAMDGVPVETTIGNLKQIVTILRAKNPSIVILIGTVIPRGGYGSNLPALNSAIPGI
AASMSTPSSPIVIVDQFTGYDGYDDNQPKRYLHPNQQGEQKIAARYAAALAPYLESPGPY
TDLSIPGRVEAEAYDKGGEGVAYHDTTTGNQGGAYRQDDVDIESGASGYDLCFIRDGEWV
NYTVNVAAAGEYTATFRTAAWNDGHTITLSVDGTSVGSAGLANTGSSEAYVDTTMSVSLS
AGTHTLTVQFSGDGENLDYLSFAAVPVTTPTSRPTLQPIPPSTLQPTDPDQDGLYEDLNG
NGALDFNDVVLFFDRMDWIAGYEPVEVFDFDRNGRIDFNDIVRVFSLL
Download sequence
Identical sequences B8GJX4
521011.Mpal_0404 gi|219851069|ref|YP_002465501.1| WP_012617097.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]