SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219851524|ref|YP_002465956.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851524|ref|YP_002465956.1|
Domain Number 1 Region: 46-391
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.94e-51
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 390-579
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 9.03e-50
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219851524|ref|YP_002465956.1|
Sequence length 580
Comment 5'-nucleotidase [Methanosphaerula palustris E1-9c]
Sequence
MTLDPRQKTIPNSLQFLIGLCILGLLILTPILLVGHPAGPVTAPLANGTVHVKILAVNDF
HGHLPPGQTMNNRTVGGAPVLASYLKSAITSEKADGTIIAIPGDVYGNSPPESGLLLDEP
TMLFFNSFADQNTTTLSSSPNSSGNMIATLGNQDFDRGVPELMREINGGNGTTNITHLVD
PYPGSRSTYVSANVVWKANNTTILPPYTIRNVSGVPIAFIGADTITTPGLQEAANVKDVT
FLDEADSINRYIPEIQQQGVHAIVVLLHEGGNQTPYDGPTRGNGTVTGRVATIIPRLDSD
VDVVLSAHTHQFTNTYLNNSGNKPVLVTQAYMFGMGFADVDLTIDRAGGDITNKSARIIT
TYADQAPGTSPDPAAAALLAADEKAVAPMVKQVIGVAAQNITRDQNPAGESALGDLIADE
LRGTMEADIGFESAGSIRADITQGNISWGDLYAVQPSSGTVLSMTLTGDQIRQVLEQQWQ
EPLPPHNLMVSGLVYTYDTTRPAGNRVTEVKVHDRPLDLNATYTVATVDYLLSGGDGYTT
FTQGKDVTFVLKDIDALTAYIGSSPQPVNVTIDGRIQRIH
Download sequence
Identical sequences B8GGH8
WP_012617552.1.75456 521011.Mpal_0875 gi|219851524|ref|YP_002465956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]