SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219851860|ref|YP_002466292.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851860|ref|YP_002466292.1|
Domain Number 1 Region: 72-155
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.74e-23
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219851860|ref|YP_002466292.1|
Sequence length 155
Comment transcription activator effector binding [Methanosphaerula palustris E1-9c]
Sequence
MEEIQIIEVLPQLVLGMRQKGAYRDIPAMLGELYIYGISHQSVLTGPPVFICHEGSVEEA
MVANETGDADMEVAFPIEGSIEGEGPISIYELPGGRMAKVLHRGPYEDCGPTYTRLFAWI
EEQGLAVTGPVREVYLNDPTLVKPEELMTEIHVPI
Download sequence
Identical sequences B8GHG4
gi|219851860|ref|YP_002466292.1| 521011.Mpal_1231 WP_012617888.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]