SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219851914|ref|YP_002466346.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219851914|ref|YP_002466346.1|
Domain Number 1 Region: 1-222
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 1.24e-49
Family NIF3 (NGG1p interacting factor 3)-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219851914|ref|YP_002466346.1|
Sequence length 238
Comment hypothetical protein Mpal_1289 [Methanosphaerula palustris E1-9c]
Sequence
MQREALIGQLEEIAPPDGAEPYDAGRIGLIIEGREEIGRICCALDATPKVIDETVQAGAD
LLVVHHTPLWNPITTVDGPTASLLRAVLSAELNIYVMHTNFDHAPDGINTGLASLLSLTD
PEPMSLGLVGTVTLSLSEMVDRLNAGPVRIYGTLDRLERLAVVGGGGFDPCLLAEAKKMG
ADVFLSSEMKHSVARAAPLPCIESTHYALEAPGMQALAERMNWTYIPDQPELSIFPSL
Download sequence
Identical sequences B8GHL8
gi|219851914|ref|YP_002466346.1| 521011.Mpal_1289 WP_012617942.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]