SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219852218|ref|YP_002466650.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852218|ref|YP_002466650.1|
Domain Number 1 Region: 169-359
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.59e-60
Family Actin/HSP70 0.00000223
Further Details:      
 
Domain Number 2 Region: 361-517
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 2.09e-56
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000027
Further Details:      
 
Domain Number 3 Region: 5-165
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.5e-49
Family Actin/HSP70 0.00000985
Further Details:      
 
Weak hits

Sequence:  gi|219852218|ref|YP_002466650.1|
Domain Number - Region: 511-583
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00589
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|219852218|ref|YP_002466650.1|
Sequence length 633
Comment chaperone protein DnaK [Methanosphaerula palustris E1-9c]
Sequence
MSKEKIIGIDLGTSNSEAAVMLGGKPTIIPSAEGATVAGKMFPSYVAFSTDGQLLVGEPA
RRQAVSNPEGTVTAAKRKMGSDHIYKIFDKEYTPQQISSFLLQKIKRDAEAFLGETITKA
VITVPAYFNDNQRTATKDAGKIAGLDVVRLVNEPTAASMAYGLDRGGEYKILVFDLGGGT
LDVTIMEFGGGTFTVLATSGDTQLGGTDMDNVIYEWIAAEFQKLEGIDIRNDKMAINRVK
EAAEKAKIELSTVLETEINLPYLSATQAGPKHLSLKLSRSKLEQLVEPIIKRCIQPFEQA
LKDAKLKKDDIQKVILVGGPTRMPVVQKFIEDHVGKKMERGIDPMECVAMGAAIQGAILG
GEITDMVLLDVTPLTLGIETLGGVRTALIERNTTIPTRKSEVFSTAADLQTSVTIHVLQG
ERPLAADNVSLGQFNLVGIPPAPRGVPQVDVTFDIDASGILNVSAKDRGTGKEQKMTITA
STKLAENDVRKMVDEAKQYEAQDRERKEEIEARNAADSLIYTADKTKADLAGKVSAELIE
KMNAAIVTLKAALEGKDTPRIKSETEKLQTVLGEVGSAVYQEEAARQQAQEQAGTQTGSA
GWESNGSGQAQGEESKNPDENVVDADFKVHDEK
Download sequence
Identical sequences B8GIW4
WP_012618246.1.75456 gi|219852218|ref|YP_002466650.1| 521011.Mpal_1615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]