SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219852809|ref|YP_002467241.1| from Methanosphaerula palustris E1-9c

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219852809|ref|YP_002467241.1|
Domain Number 1 Region: 24-43,83-238
Classification Level Classification E-value
Superfamily SGNH hydrolase 7.33e-34
Family Acetylhydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219852809|ref|YP_002467241.1|
Sequence length 378
Comment G-D-S-L family lipolytic protein [Methanosphaerula palustris E1-9c]
Sequence
MKRTSIGIMILLGSLLFLGVGTTAVSATVHILPLGDSLTKGMTDTPEDANLPSYRYWLYN
DLKSAGYDFDFVGSWTEPNFAFSFDQHNEGHGGYTTDGILNGASDDPAQGKLSQWLTGYH
ADVVLLMIGTNDVLHQVPTDTSVSNIGAIIDTVRARNPNAKFLLASIPPTSISRDNLNAL
NARIPALASQKSTAQSPVYFVDQYTGYDGVNDNVASSGVHPDKSGEIKLATNWFNALKQV
LGGSAVTTTTTVQTTVPVTTAVPVQTVAIQTAAVQTAVTVQPTAVQTVAATATTQSVIAS
SAFGSSFGLGKNFVLGDTSFAAPAGVTQSSGSSWSSSSWGSFSTVSSGFTGTASSTSLTP
PNQMFVRWYPSNFPAGRV
Download sequence
Identical sequences B8GE17
521011.Mpal_2225 WP_012618837.1.75456 gi|219852809|ref|YP_002467241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]